|
|
| (One intermediate revision by the same user not shown) |
| Line 1: |
Line 1: |
| {{SI}}
| | #REDIRECT [[Corticotropin-releasing hormone]] |
| {{CMG}}
| |
| | |
| {{EH}}
| |
| | |
| == Overview ==
| |
| | |
| '''Corticotropin-releasing hormone''' ('''CRH'''), originally named '''corticotropin-releasing factor''' ('''CRF'''), and also called '''corticoliberin''', is a [[polypeptide]] [[hormone]] and [[neurotransmitter]] involved in the [[stress (medicine)|stress response]].
| |
| | |
| ==Hormonal actions==
| |
| CRH is produced by neuroendocrine cells in the [[paraventricular nucleus]] of the [[hypothalamus]] and is released from neurosecretory terminals of these neurons into the primary capillary plexus of the [[hypothalamo-hypophyseal portal system]]. The portal system carries the CRH to the [[anterior pituitary|anterior lobe]] of the [[pituitary gland|pituitary]], where it stimulates [[corticotrope]]s to secrete [[corticotropin]] (ACTH) and other biologically active substances (for example [[β-endorphin]]).
| |
| | |
| ά-helical CRH-(9--41) acts as a CRH antagonist<ref>Santos, Javier, Paul R. Saunders, Nico P. M. Hanssen,
| |
| Ping-Chang Yang, Derrick Yates, Jack A. Groot, and Mary H. Perdue. Corticotropin-releasing hormone mimics
| |
| stress-induced colonic epithelial pathophysiology in the rat. Am. J. Physiol. 277 (Gastrointest. Liver Physiol. 40): G391-G399, 1999</ref>.
| |
| | |
| ==Role in parturition==
| |
| CRH is also synthesized by the [[placenta]] and seems to determine the duration of [[pregnancy]]<ref>http://users.rcn.com/jkimball.ma.ultranet/BiologyPages/H/Hypothalamus.html#CRH</ref>.
| |
| | |
| ==Structure==
| |
| The 41-[[amino acid]] sequence of CRH was first discovered in sheep by Vale ''et al'' in [[1981]]<ref>Vale,W., Spiess,J., Rivier,C. and Rivier,J. ''Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and beta-endorphin'' Science 213 (4514), 1394-1397 (1981)</ref>. Its full sequence is
| |
| | |
| SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA
| |
| | |
| ==See also==
| |
| * [[Corticotropin releasing hormone receptor]]
| |
| * [[Proopiomelanocortin]]
| |
| * [[Hypothalamic-pituitary-adrenal axis]]
| |
| | |
| ==References==
| |
| | |
| <references/>
| |
| | |
| == Acknowledgements ==
| |
| The content on this page was first contributed by: C. Michael Gibson, M.S., M.D.
| |
| | |
| Initial content for this page in some instances came from [http://www.wikipedia.org Wikipedia]
| |
| | |
| '''List of contributors:'''
| |
| | |
| == Suggested Reading and Key General References ==
| |
| | |
| == Suggested Links and Web Resources ==
| |
| | |
| == For Patients ==
| |
| | |
|
| |
| {{SIB}}
| |
| ----
| |
| [[cs:Kortikoliberin]]
| |
| [[de:Corticotropin Releasing Hormone]]
| |
| [[fr:Corticolibérine]]
| |
| [[it:Ormone di liberazione della corticotropina]]
| |
| [[mk:Адренокортикотропен ослободувачки хормон]]
| |
| [[ja:副腎皮質刺激ホルモン放出ホルモン]]
| |
| [[pl:Kortykoliberyna]]
| |
| [[ru:Кортиколиберин]]
| |
| [[sl:Kortikoliberin]]
| |
| | |
| [[Category:DiseaseState]]
| |
| [[Category:Hormone]]
| |
| [[Category:Endocrinology]]
| |
| {{WikiDoc Help Menu}}
| |
| {{WikiDoc Sources}}
| |