CRH

WikiDoc Resources for CRH
Articles
Most recent articles on CRH Most cited articles on CRH Review articles on CRH Articles on CRH in N Eng J Med, Lancet, BMJ
Media
Powerpoint slides on CRH Images of CRH Photos of CRH Podcasts & MP3s on CRH Videos on CRH
Evidence Based Medicine
Cochrane Collaboration on CRH Bandolier on CRH TRIP on CRH
Clinical Trials
Ongoing Trials on CRH at Clinical Trials.gov Trial results on CRH Clinical Trials on CRH at Google
Guidelines / Policies / Govt
US National Guidelines Clearinghouse on CRH NICE Guidance on CRH NHS PRODIGY Guidance FDA on CRH CDC on CRH
Books
Books on CRH
News
CRH in the news Be alerted to news on CRH News trends on CRH
Commentary
Blogs on CRH
Definitions
Definitions of CRH
Patient Resources / Community
Patient resources on CRH Discussion groups on CRH Patient Handouts on CRH Directions to Hospitals Treating CRH Risk calculators and risk factors for CRH
Healthcare Provider Resources
Symptoms of CRH Causes & Risk Factors for CRH Diagnostic studies for CRH Treatment of CRH
Continuing Medical Education (CME)
CME Programs on CRH
International
CRH en Espanol CRH en Francais
Business
CRH in the Marketplace Patents on CRH
Experimental / Informatics
List of terms related to CRH

Editor-In-Chief: C. Michael Gibson, M.S., M.D. [1]

Please Take Over This Page and Apply to be Editor-In-Chief for this topic: There can be one or more than one Editor-In-Chief. You may also apply to be an Associate Editor-In-Chief of one of the subtopics below. Please mail us [2] to indicate your interest in serving either as an Editor-In-Chief of the entire topic or as an Associate Editor-In-Chief for a subtopic. Please be sure to attach your CV and or biographical sketch.

Overview

Corticotropin-releasing hormone (CRH), originally named corticotropin-releasing factor (CRF), and also called corticoliberin, is a polypeptide hormone and neurotransmitter involved in the stress response.

Hormonal actions

CRH is produced by neuroendocrine cells in the paraventricular nucleus of the hypothalamus and is released from neurosecretory terminals of these neurons into the primary capillary plexus of the hypothalamo-hypophyseal portal system. The portal system carries the CRH to the anterior lobe of the pituitary, where it stimulates corticotropes to secrete corticotropin (ACTH) and other biologically active substances (for example β-endorphin).

ά-helical CRH-(9--41) acts as a CRH antagonist.

Role in parturition

CRH is also synthesized by the placenta and seems to determine the duration of pregnancy.

Structure

The 41-amino acid sequence of CRH was first discovered in sheep by Vale et al in 1981. Its full sequence is

SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA

See also

• Corticotropin releasing hormone receptor
• Proopiomelanocortin
• Hypothalamic-pituitary-adrenal axis

Acknowledgements

The content on this page was first contributed by: C. Michael Gibson, M.S., M.D.

Initial content for this page in some instances came from Wikipedia

List of contributors:

---